powered by:
Protein Alignment Zasp66 and gras-1
DIOPT Version :9
Sequence 1: | NP_729395.2 |
Gene: | Zasp66 / 38988 |
FlyBaseID: | FBgn0035917 |
Length: | 430 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_492164.1 |
Gene: | gras-1 / 172549 |
WormBaseID: | WBGene00009272 |
Length: | 245 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 16/53 - (30%) |
Similarity: | 26/53 - (49%) |
Gaps: | 5/53 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 RRSSSGLKKRVHFADEQNVGVQVGSPA-HGELLRGDIISKIGEYDARDLSHAD 99
:|:||...:|:.:.|. |...||| ...:.|||::..:.|......|||:
Worm 79 KRTSSNSYERITYVDY----VSADSPADRCGITRGDMVIAVNEKSVVTASHAE 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.