DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and ceh-45

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_490823.1 Gene:ceh-45 / 171689 WormBaseID:WBGene00022837 Length:229 Species:Caenorhabditis elegans


Alignment Length:282 Identity:55/282 - (19%)
Similarity:92/282 - (32%) Gaps:88/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PFLPGPSHFERALQLPVDTLPQTVFP---QLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVN 217
            |||..|           :|:.:.|.|   .::||......||.||          :|    .:::
 Worm     5 PFLMTP-----------ETMNKLVTPNSASISSSSSSPSTSTSFS----------ID----TLLS 44

  Fly   218 QPYRTTPLV--------LPGAKVKKDAPTTESYLRHYP---------NPAVRAHPGHDYHDSIMK 265
            .|....|.:        ..||.....|...:.:..:||         .|...|...|.::.|..|
 Worm    45 NPLAGIPQLHNFQDPFGAVGAAAAASALPWQFHPANYPFFSMLCGPLMPPFMAPYHHQHYASRRK 109

  Fly   266 QRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIEDTIRST-VPFATSESN-----RLKDS 324
            :|      |:.:.||...                 |.:|.|..:| .|.||:...     .||:.
 Worm   110 RR------HRTIFSEEQL-----------------NILETTFSTTHYPDATTREELAVQCSLKEE 151

  Fly   325 PLHRPLPTKLNGYKKTVQYDPRNSETYRAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNRLVPGK 389
            .:......:....:|..:.|.|.|:            :.|..|..:.:.....||.:..|.....
 Worm   152 RVEVWFKNRRAKERKQKKDDSRTSK------------HSGDDSECDESDEDTRKVKRIKRENSSG 204

  Fly   390 KPVSAPVSRPPYNVVNTHDENI 411
            |..|:|.|:.  ::..:|.||:
 Worm   205 KETSSPESKA--SLKTSHSENL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492
DUF4749 285..359 CDD:292558 13/79 (16%)
ceh-45NP_490823.1 Homeobox 112..166 CDD:365835 12/70 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.