DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Grid2ip

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001152793.1 Gene:Grid2ip / 170935 MGIID:2176213 Length:1203 Species:Mus musculus


Alignment Length:500 Identity:101/500 - (20%)
Similarity:156/500 - (31%) Gaps:163/500 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSSASASFSRPAFWKVPGYELPTSYRPQPTPKPPLVPLPSPCR-----RRSSSGLKKRVH-FADE 63
            |...|.|..||.       .|..|.|....|:.|..|.|....     |....|.::.|. :...
Mouse   218 RLRRSRSEERPE-------RLLVSTRASAAPRRPDEPPPRKATSLLGGRTGPGGPRRTVRVYKGN 275

  Fly    64 QNVG-------------VQVGSPAHGELLR-GDIISKIGEYDARDLSHADAQQLFRGAGNEIRLV 114
            ::.|             |..||||....|: ||.|..:...|.|:.||.....:.:|:|....||
Mouse   276 KSFGFTLRGHGPVWIESVLPGSPAENASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLV 340

  Fly   115 VHRDNKIAYTQGATQEAGPGSRSNSTLPPVTPDLMPH----RGPS------PFLPGPSHF----- 164
            | .:..:.:...:.....|...|..|......|::|.    :|.:      ..|..|..:     
Mouse   341 V-EEGPVPFASDSDSLDSPTRASALTSLQWVADILPSSIRVQGRTFSQQLDHLLTPPERYGVCRA 404

  Fly   165 -ERALQ-LPVDTLPQTVFPQLNSSG----------------------------GY---------- 189
             ||..| ..:|||...|:|.|::..                            ||          
Mouse   405 LERFFQHRNIDTLIVDVYPVLDTPAKQVLWQFLYQLLTYEEQELCQEKIACFLGYTAMTEPESSL 469

  Fly   190 --EVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTTPL-----------------VLPGAKVKKD 235
              |..||   |:||.:.|.......:::..:..|:..|                 ::||.:...|
Mouse   470 DLEPEST---PEPTPEPQPRSSLRASSMCRRSLRSQGLETSLSCGPGDCPEMPLPLIPGERQAGD 531

  Fly   236 APTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQFNSPIGLYSN 300
            ..:    |...|||.:.:                      .|.:|.::.  .:..|...||..|.
Mouse   532 GTS----LPETPNPKMMS----------------------AVYAELESR--LNSSFKGKIGTMSK 568

  Fly   301 NNIEDTIRSTV----PFATS----ESNRLKDSPLHRPLPTKLNGYKKTVQYDPRNSETY------ 351
            :.....:.|.|    |...|    .|:||..||.:.||.:  .|..     .|.:||::      
Mouse   569 SRASPPVPSLVGTSGPRTLSGVSWPSDRLLPSPCYDPLCS--GGLA-----SPSSSESHPYASLD 626

  Fly   352 --RAIQEEGGYSNYGQSSPQEVTIPVQTKVYQPNR--LVPGKKPV 392
              ||...:.|..:....||     |....:..|:|  |....:||
Mouse   627 SSRAPSPQPGLGSIHADSP-----PSPDPIRPPSRRKLFAFSRPV 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 16/47 (34%)
DUF4749 285..359 CDD:292558 21/89 (24%)
Grid2ipNP_001152793.1 PDZ_signaling 9..69 CDD:238492
HN_L-delphilin-R1_like 122..201 CDD:259820
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..270 14/58 (24%)
PDZ_signaling 269..342 CDD:238492 20/73 (27%)
HN_L-delphilin-R2_like 378..457 CDD:259821 12/78 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..541 14/81 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..586 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..656 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 710..821
FH2 812..1180 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.