DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Lhx8

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_034843.2 Gene:Lhx8 / 16875 MGIID:1096343 Length:367 Species:Mus musculus


Alignment Length:192 Identity:39/192 - (20%)
Similarity:69/192 - (35%) Gaps:59/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CRRRSSSG---------LKKRVHF---ADEQNVGVQVGSPAHGELLRGDIISKIGEYDARDLSHA 98
            |:|:.|:|         :..||||   .|.....|:.|   :|..:.|.::::      :|::|.
Mouse   188 CKRQLSTGEEFALVEEKVLCRVHFDCMLDNLKREVENG---NGISVEGALLTE------QDVNHP 243

  Fly    99 DAQQLFRGAGNEIRLVVHR------DNKIAYT-QGATQEAGPGSR-------------------S 137
            ...:..|.:....:|.|.:      :|..|.| |...:..|...|                   :
Mouse   244 KPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPN 308

  Fly   138 NSTLPPVT--------PDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEV 191
            :|:..|||        |.::.....|.::|.......||...:|...|.    |:||..|.:
Mouse   309 HSSSAPVTAVPSSRLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAHQQL----LDSSPCYPI 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 8/46 (17%)
DUF4749 285..359 CDD:292558
Lhx8NP_034843.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..79
LIM1_Lhx7_Lhx8 95..150 CDD:188767
LIM2_Lhx7_Lhx8 157..211 CDD:188769 6/22 (27%)
Homeobox 250..302 CDD:278475 9/51 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.