DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and DMBX1

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001374705.1 Gene:DMBX1 / 127343 HGNCID:19026 Length:382 Species:Homo sapiens


Alignment Length:236 Identity:43/236 - (18%)
Similarity:73/236 - (30%) Gaps:91/236 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ELPTSYRPQPTPKPPLVPLPSP---------------------------CRRRSSSGLKKRVHFA 61
            |.||......|.:||.:|...|                           .|..:.....::...|
Human   154 EAPTPDTQLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQPDREEDPRAGAEDPKAEKSPGA 218

  Fly    62 DEQNVGVQVGSP---AHGELL------RGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHR 117
            |.:.:|.:.|||   :.|.|.      .|.::.....|.:..||....|:.||      :.:...
Human   219 DSKGLGCKRGSPKADSPGSLTITPVAPGGGLLGPSHSYSSSPLSLFRLQEQFR------QHMAAT 277

  Fly   118 DNKIAYTQGATQEAGP---GSRSNSTLPPVTPDLMP-------------------HRG--PSPFL 158
            :|.:.|:  :.:..||   .:.:.:.:|.:..::.|                   |:|  .||.|
Human   278 NNLVHYS--SFEVGGPAPAAAAAAAAVPYLGVNMAPLGSLHCQSYYQSLSAAAAAHQGVWGSPLL 340

  Fly   159 PGP-----------------------SHFERALQLPVDTLP 176
            |.|                       ...:.|..|.:||||
Human   341 PAPPAGLAPASATLNSKTTSIENLRLRAKQHAASLGLDTLP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 12/55 (22%)
DUF4749 285..359 CDD:292558
DMBX1NP_001374705.1 Interaction with OTX2 and is required for repressor activity. /evidence=ECO:0000250|UniProtKB:Q91ZK4 1..156 1/1 (100%)
Homeobox 74..128 CDD:395001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..252 18/97 (19%)
OAR 357..373 CDD:397759 0/15 (0%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 359..372 0/12 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.