DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and Pdlim3

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_446102.2 Gene:Pdlim3 / 114108 RGDID:620427 Length:364 Species:Rattus norvegicus


Alignment Length:419 Identity:92/419 - (21%)
Similarity:151/419 - (36%) Gaps:123/419 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PKPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQVGSPAH-GELLRGDIISKIGEYDARDLSHA 98
            |:..::|.|:|...|.|.|:.........:   :..||.|. ..|..||:|..|..:....::||
  Rat     2 PQNVVLPGPAPWGFRLSGGIDFNQPLVITR---ITPGSKAEAANLCPGDVILAIDGFGTESMTHA 63

  Fly    99 DAQQLFRGAGNEIRLVVHRDNKIAYTQGATQE--AGPGSRSNSTLPPVTPDLMPHR---GPSPFL 158
            |||...:.|..::.|.:.|.....::...:::  |.| .:.|....|...:...|:   .|.||:
  Rat    64 DAQDRIKAASYQLCLKIDRAETRLWSPQVSEDGKAHP-FKINLEAEPQDVNYFEHKHNIRPKPFI 127

  Fly   159 PGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDHQQDVDEEQAAIVNQPYRTT 223
                       :|..|...:....::...|...||:|                         .|.
  Rat   128 -----------IPGRTSGCSTPSGIDCGSGRSTPSSV-------------------------STV 156

  Fly   224 PLVLPG-AKV-KKDAPTTESYLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRV 286
            ..:.|| .|| .|.||..         |.....||                           .::
  Rat   157 STICPGDLKVAAKMAPNI---------PLEMELPG---------------------------VKI 185

  Fly   287 FHKQFNSPIGLYSNNNIEDTIRSTVPFATSESNRLKDSPLHRPLPTKLNGYKKTVQYD------- 344
            .|.|||:|:.|||::||.:|::..|..|..|:..:.:..  ..:|.:.:.|:  :.:|       
  Rat   186 VHAQFNTPMQLYSDDNIMETLQGQVSTALGETPSMSEPT--ASVPPQSDVYR--MLHDNRDEPAA 246

  Fly   345 PRNSETYRAIQE---EGGYSNYGQSSPQEVTIPVQTKVY--------QPNRLVPGKKPVSAPV-S 397
            ||.|.::|.:||   :|  |:...:..:.|..|| |||:        .|.....|...|.|.| :
  Rat   247 PRQSGSFRVLQELVNDG--SDDRPAGTRSVRAPV-TKVHGGAGGAQRMPLCDKCGSGIVGAVVKA 308

  Fly   398 RPPYNVVNTHDE---------NIRQSGSF 417
            |..|.    |.|         |::|.|.|
  Rat   309 RDKYR----HPECFVCADCNLNLKQKGYF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 15/47 (32%)
DUF4749 285..359 CDD:292558 23/83 (28%)
Pdlim3NP_446102.2 PDZ_signaling 2..80 CDD:238492 22/80 (28%)
DUF4749 184..263 CDD:406377 23/82 (28%)
LIM_ALP 294..346 CDD:188834 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5207
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.