DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and LDB3

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001165081.1 Gene:LDB3 / 11155 HGNCID:15710 Length:732 Species:Homo sapiens


Alignment Length:384 Identity:81/384 - (21%)
Similarity:138/384 - (35%) Gaps:95/384 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 AHGELLRGDIISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKIAYTQGATQEAGPGSRSN 138
            |..:|.:||::..|...:...::|.:||...:.|...:.|.:.:..:            |...| 
Human    39 AQSQLSQGDLVVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQKSKR------------PIPIS- 90

  Fly   139 STLPPVTPDLMPHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRD 203
            :|.|||                        |.|:..:|....|.|:::|....|    ||.|   
Human    91 TTAPPV------------------------QTPLPVIPHQKDPALDTNGSLVAP----SPSP--- 124

  Fly   204 HQQDVDEEQAAIVNQPYRTTPLVLPGAKVKKDAPTTESYLRHYPNPA-VRAHPGHDYHDSIMKQR 267
                   |..|....|  .||.:.|........|:..|.|....:|. .||.         ::.:
Human   125 -------EARASPGTP--GTPELRPTFSPAFSRPSAFSSLAEASDPGPPRAS---------LRAK 171

  Fly   268 VADTMLHKVVGSEADTGRVFHKQFNSPIGLYSNNNIED-------TIRST-----VPFATSESNR 320
            .:......::|.:|..|....:|:|:||||||...:.:       ::|..     :|.......|
Human   172 TSPEGARDLLGPKALPGSSQPRQYNNPIGLYSAETLREMAQMYQMSLRGKASGVGLPGGADYQER 236

  Fly   321 -----LKDSPL--HRPLPTKLNGYKKTV---QYD-PRNSETYRAIQEEGGYSNYGQSSPQEVTIP 374
                 ||||.|  |:|:..|..|.|.|:   ||: |.:..:..||.:........|.|....::|
Human   237 FNPSALKDSALSTHKPIEVKGLGGKATIIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFSGSLP 301

  Fly   375 VQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSGSFNRLMYSVIG---ATEY 430
            ::      :..|....||...|.:......:..||..|:|.:.....:.::.   .||:
Human   302 IK------DLAVDSASPVYQAVIKSQNKPEDEADEWARRSSNLQSRSFRILAQMTGTEF 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 10/40 (25%)
DUF4749 285..359 CDD:292558 27/96 (28%)
LDB3NP_001165081.1 PDZ_signaling 5..81 CDD:238492 10/41 (24%)
DUF4045 <77..180 CDD:330572 29/164 (18%)
ZM 189..214 CDD:128974 8/24 (33%)
DUF4749 263..353 CDD:318205 17/95 (18%)
Atrophin-1 <387..554 CDD:331285
LIM1_ZASP_Cypher 556..607 CDD:188838
LIM2_Enigma_like 615..666 CDD:188748
LIM3_Enigma_like 674..727 CDD:188749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5310
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.180

Return to query results.
Submit another query.