DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp66 and whrna

DIOPT Version :9

Sequence 1:NP_729395.2 Gene:Zasp66 / 38988 FlyBaseID:FBgn0035917 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_002665968.3 Gene:whrna / 100334777 ZFINID:ZDB-GENE-091118-27 Length:939 Species:Danio rerio


Alignment Length:223 Identity:58/223 - (26%)
Similarity:87/223 - (39%) Gaps:69/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LPTSYRPQPTPKPPLVPLPSPCRRRSSSGLKKRVHFADEQNVGVQV-----GSPAHGELLR-GDI 83
            |..::.|:|..:...|.|.   |.:|:.||...:....|..||:.|     ||.|..|.|| ||.
Zfish   162 LGRNFLPEPPGEIRQVILK---RHKSNEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRMGDQ 223

  Fly    84 ISKIGEYDARDLSHADAQQLFRGAGNEIRLVVHRDNKI--------AYTQGATQEAGPGSRSNST 140
            |.|:.:.....::||||.::.:|: .::.:.|....:|        .||.     ..|..||.| 
Zfish   224 IMKVNDKVFDRVTHADAVKVLKGS-KKLCMSVRSVGRIPGGYITNHVYTW-----VDPQGRSVS- 281

  Fly   141 LPPVTPDLM-PHRGPSPFLPGPSHFERALQLPVDTLPQTVFPQLNSSGGYEVPSTVFSPKPTRDH 204
             ||  |||: .||..                   ||.::     ||.|              |.|
Zfish   282 -PP--PDLLAEHRSA-------------------TLRRS-----NSQG--------------RSH 305

  Fly   205 Q---QDVDEEQAAIVNQPYRTTPLVLPG 229
            .   ||.||::..:|....|:..|::.|
Zfish   306 MQLLQDGDEKKVNLVLDDGRSLGLMIRG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp66NP_729395.2 PDZ_signaling <68..115 CDD:238492 16/52 (31%)
DUF4749 285..359 CDD:292558
whrnaXP_002665968.3 HN_L-whirlin_R1_like 25..102 CDD:259822
PDZ_signaling 174..255 CDD:238492 25/84 (30%)
PDZ_signaling 314..394 CDD:238492 5/20 (25%)
HN_L-whirlin_R2_like 459..538 CDD:259823
PDZ_signaling 848..919 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.