DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and USP6NL

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006717605.1 Gene:USP6NL / 9712 HGNCID:16858 Length:856 Species:Homo sapiens


Alignment Length:286 Identity:57/286 - (19%)
Similarity:105/286 - (36%) Gaps:64/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 WNTFFNDNEF--------LLQIDKDVRRLCPDISFFQQPT-DYPCEIVVHSKGEHGRRLHERVVP 174
            |..:.|..:|        .||:..:|..|..:|...::.| |      ::||.:|..|       
Human   112 WEKYKNTEKFHRRIYKGIPLQLRGEVWALLLEIPKMKEETRD------LYSKLKHRAR------- 163

  Fly   175 AVLSSANVERKGLG--MTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGM 237
                       |..  :.:|:|...|:..::....:......:.:..:|..|:..|...||.|||
Human   164 -----------GCSPDIRQIDLDVNRTFRDHIMFRDRYGVKQQSLFHVLAAYSIYNTEVGYCQGM 217

  Fly   238 NEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMS----EIRDFFI----KTLDDAEGGIKFMM 294
            ::|...:...|           .|.|.|:....|.|    .:..||:    |.|...|...|.:.
Human   218 SQITALLLMYM-----------NEEDAFWALVKLFSGPKHAMHGFFVQGFPKLLRFQEHHEKILN 271

  Fly   295 ARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIK 359
            ..||.:.:..|        |||::..:|:.:|.........|....|||||....:.:|  .|..
Human   272 KFLSKLKQHLD--------SQEIYTSFYTMKWFFQCFLDRTPFTLNLRIWDIYIFEGER--VLTA 326

  Fly   360 ICCSMILIQREAILENDFASNVKLLQ 385
            :..:::.:.::.:::......|:..|
Human   327 MSYTILKLHKKHLMKLSMEELVEFFQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 40/189 (21%)
USP6NLXP_006717605.1 TBC 125..340 CDD:214540 52/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.