DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and GYP5

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_015075.1 Gene:GYP5 / 855827 SGDID:S000006170 Length:894 Species:Saccharomyces cerevisiae


Alignment Length:320 Identity:69/320 - (21%)
Similarity:128/320 - (40%) Gaps:78/320 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LSEGPESAWNTF---------FNDNEFLLQIDKDVRRLCPDISFFQQ-PTDYPC----------- 154
            |.||.....:||         :|:.|.:.:.|:::.::  |.||:.| ..||..           
Yeast   384 LQEGQSFLKSTFTSFLENLSEYNEVENVNEEDREMFKI--DWSFWTQVVNDYATVASNEPENLEA 446

  Fly   155 ---------------EIVVHSKGEHGRRLHERVVPA-VLSSANVERKGLGMTKINLITKRSVENY 203
                           :::.:||......::|.::.. .|..|.: |:.|..||.           
Yeast   447 HVTNGIPPQIRGIIWQLMANSKSREMEDIYETLLDTECLHEATI-RRDLRRTKF----------- 499

  Fly   204 AAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCF 268
             ..|:..|:.::|::    :|:..:|..||.|||..|..|          |......||:.|...
Yeast   500 -VAEDKMESLYKVIK----VYSVYDPDVGYTQGMGFIAAP----------LLINCENEAESFGLL 549

  Fly   269 TALMSE--IRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLL 331
            ..||..  :|:.|:..:.    |:..|:.:...:|:....|:|..|..:.:....|:.:|.....
Yeast   550 VGLMKNYGLRELFLPGMP----GLMLMLYQFDRLLEEHSPSLYNRLIREGISSTMYATQWFLTFF 610

  Fly   332 SQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQ----NY 387
            :.:|||..||||:|.||.  :..:.|:|...:::|...|.:::..|...:..|:    ||
Yeast   611 AYKFPLEFVLRIFDIVFV--EGIEVLLKFAVNLMLKNEETLVKLRFDELLDFLKDELFNY 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 43/183 (23%)
GYP5NP_015075.1 COG5210 154..737 CDD:227535 69/320 (22%)
SMC_prok_B 726..>891 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.