DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and MSB3

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_014106.1 Gene:MSB3 / 855423 SGDID:S000005237 Length:633 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:59/331 - (17%)
Similarity:102/331 - (30%) Gaps:133/331 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NDNEFLLQ----IDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHERVVPAVLSSANVER 184
            |.||..:|    |::|:.|..||...||.                  .||.:..|.::.|     
Yeast   264 NPNEKQVQDLDIIERDLNRTFPDNIHFQS------------------SLHNKEGPPIIKS----- 305

  Fly   185 KGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMA 249
                                            ::|:|..::..||..||.|.||.:.|.:...:.
Yeast   306 --------------------------------LRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLD 338

  Fly   250 SDPD------LTYR----AH---------AEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMA 295
            .:..      :|.|    .|         .:.....|....:.|:..:...::|..:...|....
Yeast   339 EERAFWMLVIITSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSP 403

  Fly   296 R----LSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEF--------PLPDVLRIWDSVF 348
            .    |.||.|::.|               |....:||..:..|        |:...|||||.:|
Yeast   404 SNKKVLFNMQKNEFL---------------YRLPPITLCTASWFMSCFVGVVPIETTLRIWDCLF 453

  Fly   349 ADEQRFDFLIKICCSMILIQ---------REAILENDFASNV-----------------KLLQNY 387
            .:|..  ||.|:..:::.:.         |...|...:.||:                 :::|.:
Yeast   454 YEESH--FLFKVSLAVLKLSEHDLSKIKPRNNSLNYSWGSNLNQRGGSMGQEDSDMEIFQVIQTF 516

  Fly   388 PPIDIN 393
            |...:|
Yeast   517 PKTLLN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 38/221 (17%)
MSB3NP_014106.1 COG5210 15..540 CDD:227535 59/331 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.