DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and MDR1

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_011614.1 Gene:MDR1 / 852992 SGDID:S000003332 Length:950 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:51/235 - (21%)
Similarity:93/235 - (39%) Gaps:41/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAA--MEEGQEAHWEVVQR--- 219
            :.||:.|.|:|          |..:....:.:|....|||:..|:|  .|||       :||   
Yeast   267 NSGEYERILNE----------NAGKTSQAIDEIEKDLKRSLPEYSAYQTEEG-------IQRLRN 314

  Fly   220 ILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMS-EIRDFFIKTL 283
            :|..|:..||..||.|.||.:|......|           :|...|:|...|.. .:..::.||:
Yeast   315 VLTAYSWKNPDVGYCQAMNIVVAGFLIFM-----------SEEQAFWCLCNLCDIYVPGYYSKTM 368

  Fly   284 DDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVF 348
                .|.........:.::.:...::|.:...::.....|..|...|.....||...:||.|..|
Yeast   369 ----YGTLLDQRVFESFVEDRMPVLWEYILQHDIQLSVVSLPWFLSLFFTSMPLEYAVRIMDIFF 429

  Fly   349 ADEQRFDFLIKICCSMILIQREAILE-NDFASNVKLLQNY 387
            .:..  ..|.::..:::.|..:.||: :|....:.::::|
Yeast   430 MNGS--ITLFQVALAVLKINADDILQADDDGMFIAIIKHY 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 41/187 (22%)
MDR1NP_011614.1 COG5210 23..531 CDD:227535 51/235 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.