DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D10A

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001191169.1 Gene:TBC1D10A / 83874 HGNCID:23609 Length:515 Species:Homo sapiens


Alignment Length:343 Identity:62/343 - (18%)
Similarity:115/343 - (33%) Gaps:113/343 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VP-DVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDK 98
            || :|...|...|..:|       ::|...:|:|....:...:: .:||       |:.|.....
Human    81 VPLEVLRQRESKWLDML-------NNWDKWMAKKHKKIRLRCQK-GIPP-------SLRGRAWQY 130

  Fly    99 VDSGGVGLQDHP-----LSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVV 158
            :..|.|.||.:|     |...|        .|.::|..|::|:.|            .:|...:.
Human   131 LSGGKVKLQQNPGKFDELDMSP--------GDPKWLDVIERDLHR------------QFPFHEMF 175

  Fly   159 HSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFI 223
            .|:|.||:                                                :.:.|:|..
Human   176 VSRGGHGQ------------------------------------------------QDLFRVLKA 192

  Fly   224 YAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFIKTLD--D 285
            |....|.:||.|....|...:...|.::           ..|:|...:..: :..::.:.|:  .
Human   193 YTLYRPEEGYCQAQAPIAAVLLMHMPAE-----------QAFWCLVQICEKYLPGYYSEKLEAIQ 246

  Fly   286 AEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFAD 350
            .:|.|.|.:.:..:.:..|.||      .|::.|..|...|.....|:..|...|||:||..|.:
Human   247 LDGEILFSLLQKVSPVAHKHLS------RQKIDPLLYMTEWFMCAFSRTLPWSSVLRVWDMFFCE 305

  Fly   351 EQRFDFLIKICCSMILIQ 368
            ..:..|.:    .::|::
Human   306 GVKIIFRV----GLVLLK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 32/181 (18%)
TBC1D10ANP_001191169.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
TBC 117..320 CDD:214540 53/300 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..515
ZipA <403..>502 CDD:331990
Binding to the PDZ domain of EBP50 512..515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.