DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D3

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001116863.3 Gene:TBC1D3 / 729873 HGNCID:19031 Length:549 Species:Homo sapiens


Alignment Length:296 Identity:57/296 - (19%)
Similarity:95/296 - (32%) Gaps:85/296 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IEELVLPP---------GHSSNRAS--VDG-GDGDK-------VDSGGVGLQDHPLS-EGPESAW 119
            :.|..|||         ....:|.|  ||. ||.:|       :|....|:   |:: .||  .|
Human    52 VHETELPPLTAREAKQIRREISRKSKWVDMLGDWEKYKSSRKLIDRAYKGM---PMNIRGP--MW 111

  Fly   120 NTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKG----EHGRRLHERVVPAVLSSA 180
            :...|..|..|                :.|..|.   ::..||    ||.:|: :|.|...|...
Human   112 SVLLNTEEMKL----------------KNPGRYQ---IMKEKGKRSSEHIQRI-DRDVSGTLRKH 156

  Fly   181 NVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIY 245
            ...|...|..:..|:                       .||..|.:.||..||.:.::.|.....
Human   157 IFFRDRYGTKQRELL-----------------------HILLAYEEYNPEVGYCRDLSHIAALFL 198

  Fly   246 YVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGG-IKFMMARLSNMLKSKDLSIY 309
            ..:           .|.|.|:....|::..| ..::......|| ::.:..:..:::.:......
Human   199 LYL-----------PEEDAFWALVQLLASER-HSLQGFHSPNGGTVQGLQDQQEHVVATSQPKTM 251

  Fly   310 ELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWD 345
            .....::|..|......|..:|.....|...||:||
Human   252 GHQDKKDLCGQCSPLGCLIRILIDGISLGLTLRLWD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 25/156 (16%)
TBC1D3NP_001116863.3 TBC 99..312 CDD:214540 45/249 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.