DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d5

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001272920.1 Gene:Tbc1d5 / 72238 MGIID:1919488 Length:837 Species:Mus musculus


Alignment Length:440 Identity:109/440 - (24%)
Similarity:176/440 - (40%) Gaps:127/440 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKARVKEFEDVLAGPQDLIDLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKR 68
            |.:.:||:|::......|..::|   ...||......||::.|||.|..|...:|.|.:.:.:.|
Mouse    52 FNSYMKEWEELFVNNNYLATVRQ---KGINGQLRSSRFRSICWKLFLCVLPQDKSQWISKIKELR 113

  Fly    69 ALYKQFIEELVLPPGHSSNRASVDGGDGDKVDSGGVGLQD----HPLSEGPESAWNTFFNDNEFL 129
            |.|.. |:|:     |.:|...            ..|.||    :|||:...|.||.||.|.|..
Mouse   114 AWYSS-IKEI-----HITNPRK------------AAGQQDLMINNPLSQDEGSLWNKFFQDKELR 160

  Fly   130 LQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINL 194
            ..|::||:|..|::.||||                               .||.:          
Mouse   161 SMIEQDVKRTFPEMQFFQQ-------------------------------ENVRK---------- 184

  Fly   195 ITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRA- 258
                                 ::..:||.||:.|....|.|||:|::.||.:.:..|......| 
Mouse   185 ---------------------ILTDVLFCYARENEQLLYKQGMHELLAPIIFTLHCDHQAFLHAS 228

  Fly   259 ----------------HAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARL---------- 297
                            :.|.|.:..|:.||.....:|.....|.:.|.:.:||.:          
Mouse   229 ESAQPSEEMKTLLNPEYLEHDAYAMFSQLMETAEPWFSTFEHDGQKGKETLMAPIPFARPQDLGP 293

  Fly   298 ------------SNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFAD 350
                        .::||..|:.:|..|...|:.||.|..||:.||..:||||.|:|.:||::|||
Mouse   294 TVAIVTKVNQIQDHLLKKHDIELYMHLNRLEIAPQIYGLRWVRLLFGREFPLQDLLVVWDALFAD 358

  Fly   351 EQRFDFLIKICCSMILIQREAILENDFASNVKLLQNYPPI-DINVVIAHA 399
            ......:..:..:|:|..|:|::.:::.:.:.||.:||.| ||:.:|..|
Mouse   359 SLNLSLVDYVFTAMLLYIRDALISSNYQTCLGLLMHYPIIGDIHSLILKA 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 52/220 (24%)
Tbc1d5NP_001272920.1 TBC 79..381 CDD:214540 93/381 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001234
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.