DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d9

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001104774.1 Gene:Tbc1d9 / 71310 MGIID:1918560 Length:1264 Species:Mus musculus


Alignment Length:241 Identity:61/241 - (25%)
Similarity:91/241 - (37%) Gaps:74/241 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 VLSSANVER-------KGL---GMTKINLITK-------RSVENYAAMEEGQEAHWEVVQRILFI 223
            :||.|..|:       :||   .|.|.||.|:       ||:..:.|.:  .|.....::|:|..
Mouse   527 LLSGAINEKATHPGYYEGLVEKSMGKYNLATEEIERDLHRSLPEHPAFQ--NEMGIAALRRVLTA 589

  Fly   224 YAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEG 288
            ||..||..||.|.|| ||..:..:.|.          |.:.|:...||...:...:..|      
Mouse   590 YAFRNPNIGYCQAMN-IVTSVLLLYAK----------EEEAFWLLVALCERMLPDYYNT------ 637

  Fly   289 GIKFMMARLSNMLKSKDLSIYELLRSQELHPQYY------------SFRW-LTLLLSQEFPLPDV 340
                   |:...|  .|..::|.| :::..||.|            |..| |||.|| ..|....
Mouse   638 -------RVVGAL--VDQGVFEEL-ARDYVPQLYDCMQDLGVISTISLSWFLTLFLS-VMPFESA 691

  Fly   341 LRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQN 386
            :.:.|..|.:.      ||:...:.|    |:|:    :||..|.|
Mouse   692 VVVVDCFFYEG------IKVIFQLAL----AVLD----ANVDKLLN 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 49/201 (24%)
Tbc1d9NP_001104774.1 PH-GRAM1_TCB1D9_TCB1D9B 157..255 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 304..399 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..456
TBC 512..722 CDD:214540 59/238 (25%)
EFh <893..923 CDD:298682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1119..1162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.