DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d10b

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_653105.3 Gene:Tbc1d10b / 68449 MGIID:1915699 Length:798 Species:Mus musculus


Alignment Length:306 Identity:54/306 - (17%)
Similarity:91/306 - (29%) Gaps:122/306 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AWNTFFNDNEFLLQ--------------------IDKDVRRLCPDISFFQQPTDYPCEIVVHSKG 162
            ||....|..|.|.|                    |:||:.|            .:|...:..::|
Mouse   355 AWQYLSNSKELLEQNPGKFEELERAAGDPKWLDVIEKDLHR------------QFPFHEMFAARG 407

  Fly   163 EHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKL 227
            .||:                                                :.:.|||..|...
Mouse   408 GHGQ------------------------------------------------QDLYRILKAYTIY 424

  Fly   228 NPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFIKTLD--DAEGG 289
            .|.:||.|....:...:...|.::           ..|:|...:..: :..::...|:  ..:|.
Mouse   425 RPDEGYCQAQAPVAAVLLMHMPAE-----------QAFWCLVQICDKYLPGYYSAGLEAIQLDGE 478

  Fly   290 IKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRF 354
            |.|.:.|..:.|..:.      ||.|.:.|..|...|...:.::..|...|||:||..|.:.   
Mouse   479 IFFALLRRVSPLAHRH------LRRQRIDPVLYMTEWFMCIFARTLPWASVLRVWDMFFCEG--- 534

  Fly   355 DFLIKICCSMILIQREAILENDFASNVKL------------LQNYP 388
               :||...:.|:    :|.:...|..||            |:|.|
Mouse   535 ---VKIIFRVALV----LLRHTLGSVEKLRSCQGMYETMEQLRNLP 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 33/184 (18%)
Tbc1d10bNP_653105.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..211
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..250
TBC 343..548 CDD:214540 48/279 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 618..798
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.