DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d8

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006244913.1 Gene:Tbc1d8 / 680133 RGDID:1595491 Length:1150 Species:Rattus norvegicus


Alignment Length:330 Identity:68/330 - (20%)
Similarity:115/330 - (34%) Gaps:102/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EELVLPPGHSSNRASVDGGDGDKVDSGGVGLQD-------HPL----------SEGPE------- 116
            :::..|..:|::..:...||.:.|.|.....::       ||.          |:.|:       
  Rat   424 DDMASPVFYSTSICTDKFGDLEMVSSQSSEEREKEKSPLPHPEPLTAVFQQSGSQSPDSRLSREQ 488

  Fly   117 ---SAWNTFFND---NEFLLQIDKDVRRL----CPD-------ISFFQQPTDYPCEIVVHSKGEH 164
               |.||..|.:   ...:.:.:| :|:|    .|:       :.|....||     :....|.:
  Rat   489 IKISLWNDHFAEYGRTVCMFRTEK-IRKLVAMGIPESLRGRLWLLFSDAVTD-----LASHPGYY 547

  Fly   165 GRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNP 229
            |..:.:.:....|.:..:||.          ..||:..:.|.:  .|.....::|:|..||..||
  Rat   548 GNLVEQSLGRCCLVTEEIERD----------LHRSLPEHPAFQ--NETGIAALRRVLTAYAHRNP 600

  Fly   230 GQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFIKTLDDAEGGIKFM 293
            ..||.|.||.:...:         |.|....||  |:...|:... :.|:|...:..|:      
  Rat   601 KIGYCQSMNILTSVL---------LLYAKEEEA--FWLLVAVCERMLPDYFNHRVIGAQ------ 648

  Fly   294 MARLSNMLKSKDLSIYELLRSQELHPQY------------YSFRW-LTLLLSQEFPLPDVLRIWD 345
                      .|.|::|.|..:.| |:.            .|..| |||.|| ..||...:.:.|
  Rat   649 ----------VDQSVFEELIKEHL-PELAEHMSDLSALASISLSWFLTLFLS-IMPLESAVNVVD 701

  Fly   346 SVFAD 350
            ..|.|
  Rat   702 CFFYD 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 42/174 (24%)
Tbc1d8XP_006244913.1 PH-GRAM1_TBC1D8 171..269 CDD:270156
PH-GRAM2_TBC1D8 311..406 CDD:270160
TBC 520..726 CDD:214540 51/233 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.