DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d2b

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_919315.2 Gene:Tbc1d2b / 67016 MGIID:1914266 Length:965 Species:Mus musculus


Alignment Length:246 Identity:53/246 - (21%)
Similarity:101/246 - (41%) Gaps:55/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 HGRRLHERVVP----AVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIY 224
            |.|:..:.:.|    .:|..| :|::.....:|.|...|::.|............:.::.:|..:
Mouse   681 HTRKFKDSMEPDYFQTLLQKA-LEKQNPASKQIELDLLRTLPNNKHYSSPTSEGIQKLRSVLLAF 744

  Fly   225 AKLNPGQGYVQGMNEIVG-PIYYVMASDPDLTYRAHAEADCFFCFTALMSEI--RDFFIKTLDDA 286
            :..||..||.||:|.:|. .:.|:            .:.|.|:|...::...  ||::.|||   
Mouse   745 SWRNPDIGYCQGLNRLVAVALLYL------------DQEDAFWCLVTIVEVFMPRDYYTKTL--- 794

  Fly   287 EGGIKFMMARLSNMLKSK-DLSIYELLRSQEL-----HPQYY-------SFRWLTLLLSQEFPLP 338
                          |.|: |..::..|.|::|     |.:.|       :|.|. |::..:..:.
Mouse   795 --------------LGSQVDQRVFRDLLSEKLPRLHTHFEQYKVDYTLITFNWF-LVVFVDSVVS 844

  Fly   339 DVL-RIWDSVFADEQRFDFLIKICCSMILIQREAILE-NDFASNVKLLQNY 387
            |:| :||||...:..:..|  :...::...:.|.||: .|..|..|.|:.:
Mouse   845 DILFKIWDSFLYEGPKVIF--RFALALFKYKEEEILKLQDSMSIFKYLRYF 893

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 41/198 (21%)
Tbc1d2bNP_919315.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PH_TBC1D2A 36..144 CDD:269966
PH 38..136 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..288
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..340
HIP1_clath_bdg <341..>378 CDD:293123
RabGAP-TBC 710..878 CDD:278964 41/199 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.