DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Grtp1

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001355787.1 Gene:Grtp1 / 66790 MGIID:1914040 Length:359 Species:Mus musculus


Alignment Length:367 Identity:81/367 - (22%)
Similarity:122/367 - (33%) Gaps:134/367 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RALSW-KLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSNRA----SVDGGDGDKVDS 101
            ||:.| |||.|..|.|:|     :..||.:.|.      :|..|   ||    :|.|.......|
Mouse    47 RAIKWSKLLKGNGGVRKS-----VTVKRYVRKG------IPLEH---RARVWMAVSGAQARMDQS 97

  Fly   102 GGVGLQDHPLSEGPESAWNTFFNDNEFLLQIDK----DVRRLCPDISFFQQPTDYPCEIVVHSKG 162
            .|   ..|.|.||..|:            .:|:    |:.|..||...|::..| ||        
Mouse    98 PG---YYHRLLEGESSS------------SLDEAIRTDLNRTFPDNVMFRKTAD-PC-------- 138

  Fly   163 EHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKL 227
                                    |..|..|                          :|..|...
Mouse   139 ------------------------LQKTLYN--------------------------VLLAYGLH 153

  Fly   228 NPGQGYVQ-----------------GMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEI 275
            ||..||.|                 |||.|.|.:..:..:          |.:.|:...||:..|
Mouse   154 NPDVGYCQCCAQKPGSSAGLRSSLTGMNFIAGYLILITKN----------EEESFWLLDALVGRI 208

  Fly   276 -RDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPD 339
             .|::    ..|..|:|.....|:.:::.|..::..|:....:.......||...|.....|:..
Mouse   209 LPDYY----SPAMLGLKTDQEVLAELVRMKLPAVAALMDGHGVLWTLLVSRWFICLFVDILPVET 269

  Fly   340 VLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASNV 381
            ||||||.:|.:..:..|  ::..::|...:|.|||   ||::
Mouse   270 VLRIWDCLFNEGSKIIF--RVALTLIKQHQEFILE---ASSI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 39/199 (20%)
Grtp1NP_001355787.1 TBC 71..301 CDD:214540 64/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.