DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and tbc1d9

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_692034.2 Gene:tbc1d9 / 563578 ZFINID:ZDB-GENE-060810-33 Length:1248 Species:Danio rerio


Alignment Length:239 Identity:56/239 - (23%)
Similarity:83/239 - (34%) Gaps:74/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 MTKINLITK-------RSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYY 246
            |.|.||.|:       ||:..:.|.:  .|.....::|:|..||..||..||.|.|| ||..:..
Zfish   548 MGKYNLATEEIERDLHRSLPEHPAFQ--NEMGIAALRRVLTAYAFRNPNIGYCQAMN-IVTSVLL 609

  Fly   247 VMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYEL 311
            :.|.          |.:.|:...|:...:...:..|             |:...|  .|..::|.
Zfish   610 LYAK----------EEEAFWLLVAMCERMLPDYYNT-------------RVVGAL--VDQGVFEE 649

  Fly   312 LRSQELH-PQYY------------SFRW-LTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICC 362
            |  ..:| ||.|            |..| |||.|| ..|....:.:.|..|.:.      ||:..
Zfish   650 L--AHVHVPQLYDCMQALGVISTISLSWFLTLFLS-VMPFESAVVVVDCFFYEG------IKVIF 705

  Fly   363 SMILIQREAILE-----NDFASNVKLLQNY-----------PPI 390
            .:.|...:|.:.     .|....:.:|..|           |||
Zfish   706 QLALSVLDANIHQLLGCKDDGEAMTILGRYLDSVTNKDSTLPPI 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 49/202 (24%)
tbc1d9XP_692034.2 PH-GRAM1_TCB1D9_TCB1D9B 154..252 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 301..396 CDD:270161
TBC 510..720 CDD:214540 50/208 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.