Sequence 1: | NP_648245.2 | Gene: | GAPsec / 38987 | FlyBaseID: | FBgn0035916 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_692034.2 | Gene: | tbc1d9 / 563578 | ZFINID: | ZDB-GENE-060810-33 | Length: | 1248 | Species: | Danio rerio |
Alignment Length: | 239 | Identity: | 56/239 - (23%) |
---|---|---|---|
Similarity: | 83/239 - (34%) | Gaps: | 74/239 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 189 MTKINLITK-------RSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYY 246
Fly 247 VMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYEL 311
Fly 312 LRSQELH-PQYY------------SFRW-LTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICC 362
Fly 363 SMILIQREAILE-----NDFASNVKLLQNY-----------PPI 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GAPsec | NP_648245.2 | TBC | <191..373 | CDD:214540 | 49/202 (24%) |
tbc1d9 | XP_692034.2 | PH-GRAM1_TCB1D9_TCB1D9B | 154..252 | CDD:275420 | |
PH-GRAM2_TCB1D9_TCB1D9B | 301..396 | CDD:270161 | |||
TBC | 510..720 | CDD:214540 | 50/208 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |