DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and grtp1b

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001017810.1 Gene:grtp1b / 550508 ZFINID:ZDB-GENE-050417-346 Length:349 Species:Danio rerio


Alignment Length:191 Identity:45/191 - (23%)
Similarity:80/191 - (41%) Gaps:19/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 ENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCF 265
            :|.......|....:.:..:|..|...|...||.||||.|.|   |::....|       |...|
Zfish   133 DNIQFRHSSQSCLQKALFNVLLAYGHHNKDVGYCQGMNFIAG---YLLIITKD-------EEKSF 187

  Fly   266 FCFTALMSEI-RDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTL 329
            :...||:..| .|::.:|:    .|:|.....|..::|||..::::.:...::.......||...
Zfish   188 WLMVALIGRILPDYYTQTM----LGLKVDQEVLGELVKSKVPAVWQTMNQHDVMWTLVVSRWFIC 248

  Fly   330 LLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQNYPPI 390
            |.....|:..||||||.:|.:..:..|.:    ::.||:....|.:...|..::.:.:..|
Zfish   249 LYVDVLPVETVLRIWDCLFYEGSKILFRV----ALTLIRHNQNLISQAKSLPEICEGFKQI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 42/172 (24%)
grtp1bNP_001017810.1 TBC 76..289 CDD:214540 42/173 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.