DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D8B

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_060222.2 Gene:TBC1D8B / 54885 HGNCID:24715 Length:1120 Species:Homo sapiens


Alignment Length:386 Identity:76/386 - (19%)
Similarity:123/386 - (31%) Gaps:129/386 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKEFEDVLAGPQDLIDLKQLRKLAFN-GVPDVQSFRALSWKLLLGYLGPRRSSWTT--------- 62
            ||:||.::|            ||... |....| :..:|.:|.:       ||.:|         
Human   374 VKDFEQLVA------------KLRLRCGAASTQ-YHDISTELAI-------SSESTEPSDNFEVQ 418

  Fly    63 TLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDKVDSGGVGLQDHPLSEG-PESAWNTFFND- 125
            :|..:|...|....|.::...|..|..:               |....|.|. .|.:|...|.: 
Human   419 SLTSQRECSKTVNTEALMTVFHPQNLET---------------LNSKMLKEKMKEQSWKILFAEC 468

  Fly   126 ----NEFLLQIDKD-VRRLCPD-------------ISFFQQPTDYPCEIVVHSKGEHGRRLHERV 172
                :.|..:..:| |.|..|:             ::......||..|:|..|.|          
Human   469 GRGVSMFRTKKTRDLVVRGIPETLRGELWMLFSGAVNDMATNPDYYTEVVEQSLG---------- 523

  Fly   173 VPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGM 237
             ...|::..:||.          .:||:..:.|.:  .:.....::|:|..||..||..||.|.|
Human   524 -TCNLATEEIERD----------LRRSLPEHPAFQ--SDTGISALRRVLTAYAYRNPKIGYCQAM 575

  Fly   238 NEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFIKTLDDAEGGIKFMMARLSNML 301
            |.:...:         |.|....||  |:...|:... :.|:|.:.:..|               
Human   576 NILTSVL---------LLYAKEEEA--FWLLVAVCERMLPDYFNRRIIGA--------------- 614

  Fly   302 KSKDLSIYELLRSQELHPQY------------YSFRWLTLLLSQEFPLPDVLRIWDSVFAD 350
             ..|.:::|.|....| ||.            .|..|...|.....|:...:.:.|..|.|
Human   615 -LVDQAVFEELIRDHL-PQLTEHMTDMTFFSSVSLSWFLTLFISVLPIESAVNVVDCFFYD 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 36/173 (21%)
TBC1D8BNP_060222.2 PH-GRAM1_TBC1D8B 156..254 CDD:275419
PH-GRAM2_TBC1D8B 296..388 CDD:270159 7/25 (28%)
TBC 486..694 CDD:214540 47/239 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1035..1066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.