DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d8

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_017177250.1 Gene:Tbc1d8 / 54610 MGIID:1927225 Length:1160 Species:Mus musculus


Alignment Length:277 Identity:60/277 - (21%)
Similarity:98/277 - (35%) Gaps:85/277 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SEGPE----------SAWNTFFND---NEFLLQIDKDVRRL----CPD-------ISFFQQPTDY 152
            |:.|:          |.||..|.:   ...:.:.:| :|:|    .|:       :.|....|| 
Mouse   476 SQSPDSRLSREQIKISLWNDHFVEYGRTVCMFRTEK-IRKLVAMGIPESLRGRLWLLFSDAVTD- 538

  Fly   153 PCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVV 217
                :....|.:|..:.:.:....|.:..:||.          ..||:..:.|.:  .|.....:
Mouse   539 ----LASHPGYYGNLVEQSLGRCCLVTEEIERD----------LHRSLPEHPAFQ--NETGIAAL 587

  Fly   218 QRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFIK 281
            :|:|..||..||..||.|.||.:...:         |.|....||  |:...|:... :.|:|..
Mouse   588 RRVLTAYAHRNPKIGYCQSMNILTSVL---------LLYAKEEEA--FWLLVAVCERMLPDYFNH 641

  Fly   282 TLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQY------------YSFRW-LTLLLSQ 333
            .:..|:                .|.|::|.|..::| |:.            .|..| |||.|| 
Mouse   642 RVIGAQ----------------VDQSVFEELIKEQL-PELAEHMSDLSALASISLSWFLTLFLS- 688

  Fly   334 EFPLPDVLRIWDSVFAD 350
            ..||...:.:.|..|.|
Mouse   689 IMPLESAVHVVDCFFYD 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 42/174 (24%)
Tbc1d8XP_017177250.1 PH-GRAM1_TBC1D8 171..269 CDD:270156
PH-GRAM2_TBC1D8 311..406 CDD:270160
TBC 519..725 CDD:214540 51/233 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.