DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and grtp1

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001005632.1 Gene:grtp1 / 448089 XenbaseID:XB-GENE-950226 Length:342 Species:Xenopus tropicalis


Alignment Length:354 Identity:75/354 - (21%)
Similarity:124/354 - (35%) Gaps:112/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDKVDSGGVGL 106
            ||:.|..||         ..:...:|....|::|.: .:|..|.|:...|..|...::|. ..|.
 Frog    45 RAIKWSKLL---------QQSAAVEKNMKVKRYIRK-GIPNEHRSHVWMVVSGAQAQMDM-NTGY 98

  Fly   107 QDHPLSEGPESAWNTFFNDNEFLLQ-IDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHE 170
            .....:||.:         |..||. :..|:.|..||...||:                      
 Frog    99 FRRMFTEGEK---------NPKLLDLVITDLNRTFPDNVLFQK---------------------- 132

  Fly   171 RVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQ 235
                                ..|...::.:.|                 :|..|.:.|...||.|
 Frog   133 --------------------NANPSLQKDLYN-----------------VLVAYGQHNKTVGYCQ 160

  Fly   236 GMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEI-RDFFIKTLDDAEGGIKFMMARLSN 299
            |||.|.|   |::....|       |...|:...||:.:| .|::    ..|..|:|.....|.:
 Frog   161 GMNFIAG---YLILVTKD-------EEKAFWLMDALIGQILPDYY----SPAMTGLKTDQEVLGD 211

  Fly   300 MLKSKDLSIYELLRSQELHPQYYSF---RWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKIC 361
            ::|.|..|:.:|:   |.|...::.   ||...|.....|:..||||||.:|.:..:..|  ::.
 Frog   212 LVKKKIPSVAQLI---ETHGVMWTLLVSRWFICLFIDILPVETVLRIWDCLFFEGSKVIF--RVA 271

  Fly   362 CSMILIQREAILENDFASNVKLLQNYPPI 390
            .::|...:.:|:|         .:|:|.|
 Frog   272 LTLIKQSQASIME---------ARNFPDI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 44/185 (24%)
grtp1NP_001005632.1 TBC 69..283 CDD:214540 63/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.