DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and plx

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001163511.1 Gene:plx / 40704 FlyBaseID:FBgn0261261 Length:1572 Species:Drosophila melanogaster


Alignment Length:400 Identity:83/400 - (20%)
Similarity:144/400 - (36%) Gaps:110/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSN- 87
            |..:||.|..|..|....|.|               |.|.:.|...|.:...|..:|....:.| 
  Fly   838 LSPMRKPAKRGKRDAAELREL---------------WRTAIRQTIMLNRMETENAMLQARQNENE 887

  Fly    88 --RASVDGGD-----------------------GDKVDSGGVGLQDHPLSEG-PES----AWNTF 122
              |..:|..:                       |:|.|...:|   |.:..| |.|    .| ||
  Fly   888 LKRIKLDYEEIVPCDKQLIERWEQIIERNSTQIGNKKDPKVLG---HAIRTGVPRSKRGDVW-TF 948

  Fly   123 FNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLH---ERVVPAVLSSANVER 184
            ..:...:.....|.:|. |:.       :.|..:::....||...:.   .|..|    :....:
  Fly   949 LAEQHSMNTAPVDTKRF-PNF-------NTPYHMLLKHLTEHQHAIFIDLGRTFP----NHQFYK 1001

  Fly   185 KGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMA 249
            ..||:.:::|.                       .:|..|:.|:|..||.||:..|.|.:  ::.
  Fly  1002 DPLGLGQLSLF-----------------------NLLKAYSILDPELGYCQGLGFICGVL--LLH 1041

  Fly   250 SDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMA--RLSNMLKSKDLSIYELL 312
            .|         ||:.|.....||.. |:...|.|.|.:   ||.:.  :||.::|.....:|..|
  Fly  1042 CD---------EANSFQLLKHLMFR-RNMRTKYLPDMK---KFQLQLYQLSRLVKDHLPDLYVWL 1093

  Fly   313 RSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDF 377
            ...::.|..|:..|:..:.|.:|||..|.|::|.:|.:..  |.:.|...:::.:.::.:|..| 
  Fly  1094 DQNDVSPTLYAAPWILTVFSSQFPLGFVARVFDLLFLESS--DVIFKFAIALLSVHKQQLLAKD- 1155

  Fly   378 ASNVKLLQNY 387
              |.:.:.:|
  Fly  1156 --NFEEIMDY 1163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 41/183 (22%)
plxNP_001163511.1 PTB_TBC1D1_like 301..601 CDD:269967
DUF3350 835..880 CDD:288663 13/56 (23%)
TBC 933..1152 CDD:214540 57/271 (21%)
RILP-like <1176..1267 CDD:304877
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.