DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and grtp1a

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_998567.1 Gene:grtp1a / 406711 ZFINID:ZDB-GENE-040426-2733 Length:356 Species:Danio rerio


Alignment Length:177 Identity:45/177 - (25%)
Similarity:77/177 - (43%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 EVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEI-RDF 278
            :.:..:|..|...|...||.||||.|.|  |.::.|..:.|        .|:...||:|.| .|:
Zfish   154 QALYNVLVAYGHHNKAVGYCQGMNFIAG--YLILVSKDEET--------SFWLMEALLSRILPDY 208

  Fly   279 FIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRI 343
            :    ..|..|:|.....|..:::.|..::::|::.|.:.......||...|.....|:..||||
Zfish   209 Y----TPAMLGLKTDQEVLGELVRLKAPAVWKLMQDQGVMWTLVVSRWFICLFIDVLPVETVLRI 269

  Fly   344 WDSVFADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQNYPPI 390
            ||.:|.:..:  .|.::..::|...::.|.|         .||.|.:
Zfish   270 WDCLFYEGSK--ILFRVALTLIRHHQQEIAE---------AQNLPDV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 40/158 (25%)
grtp1aNP_998567.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
TBC 84..296 CDD:214540 40/157 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.