DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d2

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006538109.1 Gene:Tbc1d2 / 381605 MGIID:2652885 Length:923 Species:Mus musculus


Alignment Length:391 Identity:78/391 - (19%)
Similarity:128/391 - (32%) Gaps:121/391 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIFKARVKEFED--VLAGPQ-DLIDLKQLRKLAFNGVPDVQSFRALSWKLLL--GYLGPRRSSWT 61
            |:..:.|.|::|  .|..|. ::.|||.|.|        :|:....|..||.  ....|.|..|.
Mouse   546 SVGLSPVSEYDDYGFLTVPDYEMEDLKLLAK--------IQALEVRSHHLLAHEAVERPLRDRWA 602

  Fly    62 T-TLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDKVDSGGVGLQDHPLSEGPESAWNTFFND 125
            | |.....|..||.:            ||.|                  |....|. .|...   
Mouse   603 TLTELTPSAELKQLL------------RAGV------------------PREHRPR-VWRWL--- 633

  Fly   126 NEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKG-EHGRRLHERVVPAVLSSANVERKGLGM 189
                  :.:.||.|       |.|..|. |::...:. ||         ||.             
Mouse   634 ------VHRRVRHL-------QAPGCYQ-ELLARGRACEH---------PAA------------- 662

  Fly   190 TKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDL 254
            .:|.|...|:............:..:.::|:|..::..||..||.||:|.:......|:..    
Mouse   663 RQIELDLNRTFPTNKHFTCPTSSFPDKLRRVLLAFSWQNPTIGYCQGLNRLAAIALLVLED---- 723

  Fly   255 TYRAHAEADCFFCFTALMSEI--RDFFIKTLDDAEGGIKFMMARLSNML---------KSKDLSI 308
                  |...|:|..|::..|  .:::.|||..::...:.:...||..|         ...|||:
Mouse   724 ------EESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSEKLPRLTAHLGQHRVDLSL 782

  Fly   309 YELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAIL 373
                         .:|.|..::.:.......:||:||:...:..:..|  :...::.....||||
Mouse   783 -------------ITFNWFLVVFADSLISDILLRVWDAFLYEGTKVVF--RYALAIFKYNEEAIL 832

  Fly   374 E 374
            :
Mouse   833 Q 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 36/192 (19%)
Tbc1d2XP_006538109.1 PH_TBC1D2A 45..146 CDD:269966
PRK14951 <192..404 CDD:237865
COG4913 <300..>565 CDD:227250 5/18 (28%)
TBC 620..832 CDD:214540 51/294 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.