DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and CG8155

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_611029.3 Gene:CG8155 / 36698 FlyBaseID:FBgn0034009 Length:1098 Species:Drosophila melanogaster


Alignment Length:158 Identity:52/158 - (32%)
Similarity:73/158 - (46%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRA 258
            |.|.|....||..::.|..  ..:..||..||..:|...|.|||::|..|:...|          
  Fly   300 LRTDRLHPFYAGSDDNQNI--AALFNILTTYALNHPSVSYCQGMSDIASPLLVTM---------- 352

  Fly   259 HAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYS 323
            :.||..:.||.|:||.:|..|:  ||......||  |.|:..|...|...:|.|:||:.....:.
  Fly   353 NDEAQAYICFCAIMSRMRGNFM--LDGIAMTQKF--AHLTEALSFYDPEFWEYLKSQQADDLLFC 413

  Fly   324 FRWLTLLLSQEFPLPDVLRI----WDSV 347
            :|||.|.|.:|||..|.||:    |.|:
  Fly   414 YRWLLLELKREFPFEDALRMLEVQWSSL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 52/158 (33%)
CG8155NP_611029.3 TBC 225..439 CDD:214540 50/154 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456578
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.