DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d9b

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001381172.1 Gene:Tbc1d9b / 360520 RGDID:1310147 Length:1263 Species:Rattus norvegicus


Alignment Length:260 Identity:58/260 - (22%)
Similarity:100/260 - (38%) Gaps:70/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 YPCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEV 216
            |..|:|..|.|::.           |::..:||.          ..||:..:.|.:  .|.....
  Rat   535 YYAELVEKSMGKYS-----------LATEEIERD----------LHRSMPEHPAFQ--NELGIAA 576

  Fly   217 VQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFI 280
            ::|:|..||..||..||.|.||.:...:         |.|.:..||  |:...||... :.|::.
  Rat   577 LRRVLTAYAFRNPTIGYCQAMNIVTSVL---------LLYGSEEEA--FWLLVALCERMLPDYYN 630

  Fly   281 KTLDDA--EGGI-----KFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRW-LTLLLSQEFPL 337
            ..:..|  :.||     :.::.|||.  |.::|.:...:          |..| |||.|| ..|.
  Rat   631 TRVVGALVDQGIFEELTRDVLPRLSE--KMQELGVISSI----------SLSWFLTLFLS-VMPF 682

  Fly   338 PDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILE-NDFASNVKLLQNY-----------PPI 390
            ...:.|.|..|  .:....::::..:::....|.:|: :|....:.:|..|           |||
  Rat   683 ESAVVIVDCFF--YEGIKVILQVALAVLDANMEQLLDCSDEGEAMTVLGRYLDNVVNKQSISPPI 745

  Fly   391  390
              Rat   746  745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 43/190 (23%)
Tbc1d9bNP_001381172.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.