DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and GstT3

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:121 Identity:26/121 - (21%)
Similarity:50/121 - (41%) Gaps:33/121 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 FMMARLSNM--------LKS---------KDLSIYELLRSQELHPQYYSFRWLTLL---LSQEFP 336
            |::.|||||        |::         |:::.::  |...:|...|.......:   ||.:..
  Fly    60 FIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQ--RVPCIHDNGYKLAESVAILRYLSAKGK 122

  Fly   337 LPDVLRIWDSVFADEQRFD-FL------IKICCSMIL--IQREAILENDFASNVKL 383
            :|:  .::...|.|:.|.| ||      :::.|:|..  :..|.:|.....|..|:
  Fly   123 IPE--HLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 23/109 (21%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 13/62 (21%)
GstA 47..243 CDD:223698 26/121 (21%)
GST_C_Theta 135..259 CDD:198292 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.