DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d2

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006238118.1 Gene:Tbc1d2 / 313234 RGDID:1306860 Length:924 Species:Rattus norvegicus


Alignment Length:408 Identity:75/408 - (18%)
Similarity:126/408 - (30%) Gaps:157/408 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIFKARVKEFED--VLAGPQ-DLIDLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSWTT- 62
            |:..:.|.|::|  .|..|. ::.|||.|.|:.   ..:|:|...|:   |.....|.|..|.| 
  Rat   547 SVGLSPVSEYDDYGFLTVPDYEVEDLKLLAKIQ---ALEVRSHHLLA---LEAVERPLRDRWATL 605

  Fly    63 TLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGDKV------------DSGGVGLQ-------- 107
            |.....|..||.:            ||.|......:|            .|.|...:        
  Rat   606 TELMPSAELKQLL------------RAGVPREHRPRVWRWLVHRRVQHLHSSGCYQELLARGRAC 658

  Fly   108 DHPLSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPT-DYPCEIVVHSKGEHGRRLHER 171
            :||.:.                 ||:.|:.|..|....|..|| .:|                  
  Rat   659 EHPAAR-----------------QIELDLNRTFPTNKHFTCPTSSFP------------------ 688

  Fly   172 VVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQG 236
                                                       :.::|:|..::..||..||.||
  Rat   689 -------------------------------------------DKLRRVLLAFSWQNPTIGYCQG 710

  Fly   237 MNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEI--RDFFIKTLDDAEGGIKFMMARLSN 299
            :|.:......|:..          |...|:|..|::..|  .:::.|||..::...:.:...||.
  Rat   711 LNRLAAIALLVLED----------EESAFWCLVAIVETILPAEYYSKTLTASQVDQRVLQDLLSE 765

  Fly   300 ML---------KSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFD 355
            .|         :..|||:             .:|.|..::.:.......:||:||:...:..:..
  Rat   766 KLPRLTAHLGQRHVDLSL-------------ITFNWFLVIFADSLISDILLRVWDAFLYEGTKVV 817

  Fly   356 FLIKICCSMILIQREAIL 373
            |  :...::.....||||
  Rat   818 F--RYALAIFKYNEEAIL 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 33/192 (17%)
Tbc1d2XP_006238118.1 PH_TBC1D2A 44..145 CDD:269966
PH 44..137 CDD:278594
TBC 621..833 CDD:214540 48/314 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.