DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Rabgap1

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001101311.1 Gene:Rabgap1 / 311911 RGDID:1304691 Length:1065 Species:Rattus norvegicus


Alignment Length:211 Identity:38/211 - (18%)
Similarity:78/211 - (36%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LITKRSVENYAAME-----------------EGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIV 241
            ||||.|.::.|...                 :||::.:::.:    .|:..:...||.||.:.:.
  Rat   591 LITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICK----AYSVYDEEIGYCQGQSFLA 651

  Fly   242 GPIYYVMASDPDLTYRAHAEADCFFCFTALMSE--IRDFFIKTLDDAEGGIKFMMARLSNMLKSK 304
            ..:...|           .|...|.....:|.:  :|:.|.:..:|..  .||.  :|..:::..
  Rat   652 AVLLLHM-----------PEEQAFSVLVKIMFDYGLRELFKQNFEDLH--CKFY--QLERLMQEY 701

  Fly   305 DLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQR 369
            ...:|.......|....|:.:|...|.:.:|||..|..|.|.:..  :....:..:...::...:
  Rat   702 IPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLC--EGISVIFNVALGLLKTSK 764

  Fly   370 EAILENDFASNVKLLQ 385
            :.:|..||...:|..:
  Rat   765 DDLLLTDFEGALKFFR 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 34/197 (17%)
Rabgap1NP_001101311.1 PTB_Rab6GAP 141..269 CDD:269922
DUF3694 303..433 CDD:403614
TBC 559..768 CDD:214540 34/197 (17%)
ERM 790..1016 CDD:395622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.