powered by:
Protein Alignment GAPsec and CG3703
DIOPT Version :9
Sequence 1: | NP_648245.2 |
Gene: | GAPsec / 38987 |
FlyBaseID: | FBgn0035916 |
Length: | 403 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_569874.1 |
Gene: | CG3703 / 31045 |
FlyBaseID: | FBgn0040348 |
Length: | 711 |
Species: | Drosophila melanogaster |
Alignment Length: | 35 |
Identity: | 14/35 - (40%) |
Similarity: | 21/35 - (60%) |
Gaps: | 2/35 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 RVKEFEDVLAGPQDLIDLKQLRKLAFNGVPD-VQS 40
||::..:..|..:|.: |:.|...||.|:|| |||
Fly 119 RVRQIVEAPAEERDQL-LRDLEDFAFQGIPDAVQS 152
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
GAPsec | NP_648245.2 |
TBC |
<191..373 |
CDD:214540 |
|
CG3703 | NP_569874.1 |
RUN |
516..703 |
CDD:280855 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR22957 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.