DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Rabgap1l

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006250167.1 Gene:Rabgap1l / 304914 RGDID:1304620 Length:1051 Species:Rattus norvegicus


Alignment Length:378 Identity:73/378 - (19%)
Similarity:135/378 - (35%) Gaps:97/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AQKRALY---KQFIEELVLPPGHSSNRASVDGGD-----------GDKVD-----SGGVGLQDHP 110
            |.:|..|   |.|.|...:....|..:.....||           .||.:     |||     .|
  Rat   419 ANERFWYFSRKTFTETFFMRLKQSEGKGHSSAGDAIYEVVSLQRESDKEEPVTPTSGG-----GP 478

  Fly   111 LSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHERV--- 172
            .|...:.|...  :||| |.....||.:.||             |.:::|.||...|.|..:   
  Rat   479 ASPQEDEAEEE--SDNE-LSSGTGDVSKDCP-------------EKILYSWGELLGRWHNNLNAR 527

  Fly   173 -----------VPAVL-------------SSANVERKGLGMTK----INLITKRSVENYAAME-- 207
                       ||..|             :.|.:::..:.:||    .::||:.....:.|.:  
  Rat   528 PKGLPTLVKSGVPEALRAEVWQLLAGCHDNQAMLDKYRILITKDSAQESVITRDIHRTFPAHDYF 592

  Fly   208 -----EGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFC 267
                 :|||:.:::.:    .|:..:...||.||.:.:...:         |.:....:|.|...
  Rat   593 KDTGGDGQESLYKICK----AYSVYDEDIGYCQGQSFLAAVL---------LLHMPEEQAFCVLV 644

  Fly   268 FTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLS 332
            ......::||.:....:|..  .||.  :|..:::.:...:|.......|....|:.:|...|.:
  Rat   645 NIMYKYKLRDLYKNNFEDLH--CKFY--QLEKLMQEQLPDLYSHFCDLNLEAHMYASQWFLTLFT 705

  Fly   333 QEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQ 385
            .:|||..|..|.|.:..  :..:.:..:..:::...:|.:|:.||...:|..:
  Rat   706 AKFPLCMVFHIIDLLLC--EGLNIIFHVALALLKTSKEDLLQADFEGALKFFR 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 33/192 (17%)
Rabgap1lXP_006250167.1 PTB_Rab6GAP 129..257 CDD:269922
DUF3694 340..421 CDD:289256 1/1 (100%)
RabGAP-TBC 541..744 CDD:278964 36/221 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.