DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d25

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001100425.1 Gene:Tbc1d25 / 302552 RGDID:1559711 Length:688 Species:Rattus norvegicus


Alignment Length:350 Identity:85/350 - (24%)
Similarity:140/350 - (40%) Gaps:78/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDVQSFRALSWKLLLG---YLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSNRASVDGGDGD 97
            |.::.:..:|.|.::|   .|..:|||.||.     ||  .|.:.::...|.:.::.       .
  Rat   131 PLLEDWDIISPKDVIGSDVLLADKRSSLTTA-----AL--PFTQSILSQVGRTLSKV-------Q 181

  Fly    98 KVDSGGVGLQD-----HPLSEGPESAWNTFFN-------DNEFLLQI-----DKDVRRLC----- 140
            :|.|...| :|     .|||   ::.::|:.|       ..|..|:|     :..:|::.     
  Rat   182 QVLSWSYG-EDVKPFKPPLS---DAEFHTYLNHEGQLSRPEELRLRIYHGGVEPSLRKVVWRYLL 242

  Fly   141 ---PDISFFQQPTDY---PCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRS 199
               ||....::..||   ........|.|..:|::...:..:.|:         :.|..|.|.|:
  Rat   243 NVYPDGLTGRERMDYMKRKSREYEQLKSEWAQRVNPEDLEFIRST---------VLKDVLRTDRA 298

  Fly   200 VENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADC 264
            ...||..|:|  .|...:..:|..||..:|...|.|||:::..||..||      .:..||    
  Rat   299 HPYYAGPEDG--PHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVM------DHEGHA---- 351

  Fly   265 FFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTL 329
            |.||..:|..:...|..  |......||  |.|..:|:..|...|:.|:.......::.:|||.|
  Rat   352 FVCFCGIMKRLAANFHP--DGRAMATKF--AHLKLLLRHADPDFYQYLQEAGADDLFFCYRWLLL 412

  Fly   330 LLSQEFPLPDVLRI----WDSVFAD 350
            .|.:||...|.||:    |.|:..|
  Rat   413 ELKREFAFDDALRMLEVTWSSLPPD 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 49/163 (30%)
Tbc1d25NP_001100425.1 TBC 225..454 CDD:214540 58/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.