DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and Tbc1d17

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001099728.1 Gene:Tbc1d17 / 292886 RGDID:1309686 Length:646 Species:Rattus norvegicus


Alignment Length:367 Identity:79/367 - (21%)
Similarity:144/367 - (39%) Gaps:111/367 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GPQD-LIDLKQLRKLAFNG--VPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEEL 78
            ||:. |.::.:|:...|:|  .|   ..|..:||.|||||     ||.::..:.:|..::..:|.
  Rat   292 GPEGRLQNVPELKSRIFSGGLSP---GLRREAWKFLLGYL-----SWESSAEEHKAHVRKKTDEY 348

  Fly    79 VLPPGHSSNRASVDGGDGDKVDSGGVGLQDHPLSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDI 143
            .                       .:.||...:|...|.. |:..:....|  |::||.|.....
  Rat   349 F-----------------------RMKLQWKSVSAEQERR-NSLLHGYRSL--IERDVSRTDRTN 387

  Fly   144 SFFQQPTDYPCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEE 208
            .|::.|                                 |..|||:                   
  Rat   388 KFYEGP---------------------------------ENPGLGL------------------- 400

  Fly   209 GQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMS 273
                    :..||..|...:...||||||::::.||.:|:.:          |.|.|:||...|.
  Rat   401 --------LNDILLTYCMYHFDLGYVQGMSDLLSPILFVVQN----------EVDAFWCFCGFME 447

  Fly   274 EIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLP 338
            .:...|    ::::..:|..:.:|..:|:..|..:.:.|.||:.....:.||||.:...:|||.|
  Rat   448 LVHGNF----EESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLCFCFRWLLIWFKREFPFP 508

  Fly   339 DVLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASN 380
            ||||:|:.::......:..:.:.|:::.::|:.::.:.|.||
  Rat   509 DVLRLWEVLWTGLPGPNLHLLVACAILDMERDTLMLSGFGSN 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 41/181 (23%)
Tbc1d17NP_001099728.1 DUF3548 3..218 CDD:192931
TBC 308..543 CDD:214540 72/342 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.