DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D30

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_024304669.1 Gene:TBC1D30 / 23329 HGNCID:29164 Length:944 Species:Homo sapiens


Alignment Length:242 Identity:54/242 - (22%)
Similarity:97/242 - (40%) Gaps:54/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 ANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWE--VVQRILFIYAKLNPGQGYVQGMNEIVG 242
            :|.:...:|:..:..:.:....:|.    ||||..:  |::|:|..||:.|...||.||.|.:..
Human   286 SNPDDDSMGIQIVKDLHRTGCSSYC----GQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAA 346

  Fly   243 PIYYVMASDPDLTYRAHAEADCFFCFTALMSEI--RDFFIKTLDDAEGGIKFMMARLSNMLK--- 302
            .|..||..:         |.|.......|:.::  ..:|:..|    ..:...||...::|:   
Human   347 LILEVMEGN---------EGDALKIMIYLIDKVLPESYFVNNL----RALSVDMAVFRDLLRMKL 398

  Fly   303 ---SKDLSIYELLRSQELHPQY-------YSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFL 357
               |:.|...:...::|....|       ::.:|...|.:...|...||:||||||.:.......
Human   399 PELSQHLDTLQRTANKESGGGYEPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILR 463

  Fly   358 IKI-----------CC--------SMILIQREAILENDFASNVKLLQ 385
            :.:           ||        :|..:.:| :||||...:.:|:|
Human   464 VSLAIWAKLGEQIECCETADEFYSTMGRLTQE-MLENDLLQSHELMQ 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 46/217 (21%)
TBC1D30XP_024304669.1 RabGAP-TBC 296..476 CDD:306939 42/196 (21%)
DUF4682 637..785 CDD:318030
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.