Sequence 1: | NP_648245.2 | Gene: | GAPsec / 38987 | FlyBaseID: | FBgn0035916 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024304669.1 | Gene: | TBC1D30 / 23329 | HGNCID: | 29164 | Length: | 944 | Species: | Homo sapiens |
Alignment Length: | 242 | Identity: | 54/242 - (22%) |
---|---|---|---|
Similarity: | 97/242 - (40%) | Gaps: | 54/242 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 180 ANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWE--VVQRILFIYAKLNPGQGYVQGMNEIVG 242
Fly 243 PIYYVMASDPDLTYRAHAEADCFFCFTALMSEI--RDFFIKTLDDAEGGIKFMMARLSNMLK--- 302
Fly 303 ---SKDLSIYELLRSQELHPQY-------YSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFL 357
Fly 358 IKI-----------CC--------SMILIQREAILENDFASNVKLLQ 385 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GAPsec | NP_648245.2 | TBC | <191..373 | CDD:214540 | 46/217 (21%) |
TBC1D30 | XP_024304669.1 | RabGAP-TBC | 296..476 | CDD:306939 | 42/196 (21%) |
DUF4682 | 637..785 | CDD:318030 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |