DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D9

DIOPT Version :10

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_055945.2 Gene:TBC1D9 / 23158 HGNCID:21710 Length:1266 Species:Homo sapiens


Alignment Length:218 Identity:55/218 - (25%)
Similarity:82/218 - (37%) Gaps:64/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 MTKINLITK-------RSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYY 246
            |.|.||.|:       ||:..:.|.:  .|.....::|:|..||..||..||.|.|| ||..:..
Human   550 MGKYNLATEEIERDLHRSLPEHPAFQ--NEMGIAALRRVLTAYAFRNPNIGYCQAMN-IVTSVLL 611

  Fly   247 VMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYEL 311
            :.|.          |.:.|:...||...:...:..|             |:...|  .|..::|.
Human   612 LYAK----------EEEAFWLLVALCERMLPDYYNT-------------RVVGAL--VDQGVFEE 651

  Fly   312 LRSQELHPQYY------------SFRW-LTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCS 363
            | :::..||.|            |..| |||.|| ..|....:.:.|..|.:.      ||:...
Human   652 L-ARDYVPQLYDCMQDLGVISTISLSWFLTLFLS-VMPFESAVVVVDCFFYEG------IKVIFQ 708

  Fly   364 MILIQREAILENDFASNVKLLQN 386
            :.|    |:|:    :||..|.|
Human   709 LAL----AVLD----ANVDKLLN 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 49/201 (24%)
TBC1D9NP_055945.2 PH-GRAM1_TCB1D9_TCB1D9B 157..255 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 304..399 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..456
TBC 512..722 CDD:214540 53/215 (25%)
EFh <893..923 CDD:415501
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1075..1095
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1132..1164
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.