DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D9B

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_942568.2 Gene:TBC1D9B / 23061 HGNCID:29097 Length:1250 Species:Homo sapiens


Alignment Length:264 Identity:61/264 - (23%)
Similarity:97/264 - (36%) Gaps:78/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 YPCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEV 216
            |..|:|..|.|::.           |::..:||.          ..||:..:.|.:  .|.....
Human   534 YYAELVEKSTGKYS-----------LATEEIERD----------LHRSMPEHPAFQ--NELGIAA 575

  Fly   217 VQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFI 280
            ::|:|..||..||..||.|.||.:...:         |.|.:..||  |:...||... :.|::.
Human   576 LRRVLTAYAFRNPTIGYCQAMNIVTSVL---------LLYGSEEEA--FWLLVALCERMLPDYYN 629

  Fly   281 KTLDDA--EGGI-----KFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRW-LTLLLSQEFPL 337
            ..:..|  :.||     :..:.:||.  |.:||.:...:          |..| |||.|| ..|.
Human   630 TRVVGALVDQGIFEELTRDFLPQLSE--KMQDLGVISSI----------SLSWFLTLFLS-VMPF 681

  Fly   338 PDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILE-----NDFASNVKLLQNY---------- 387
            ...:.|.|..|.:.      ||:...:.|...:|.:|     :|....:.:|..|          
Human   682 ESAVVIVDCFFYEG------IKVILQVALAVLDANMEQLLGCSDEGEAMTMLGRYLDNVVNKQSV 740

  Fly   388 -PPI 390
             |||
Human   741 SPPI 744

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 46/190 (24%)
TBC1D9BNP_942568.2 PH-GRAM1_TCB1D9_TCB1D9B 153..251 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 299..394 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..443
TBC 505..715 CDD:214540 55/233 (24%)
EFh <855..906 CDD:298682
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..999
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1069..1093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1128..1157
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.