DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and tbc-18

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_509421.2 Gene:tbc-18 / 181091 WormBaseID:WBGene00018281 Length:826 Species:Caenorhabditis elegans


Alignment Length:241 Identity:57/241 - (23%)
Similarity:101/241 - (41%) Gaps:37/241 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 AVLSSANVERKGLGMTKINLITKRSVEN----YAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQ 235
            :||.....::..:|: :|.....|::.|    :....||.||...:::.:.|||    |..||.|
 Worm   179 SVLQQCAQDKPSIGV-QIERDLLRTLPNNICFWKKNSEGIEALRRILKCVAFIY----PDLGYCQ 238

  Fly   236 GMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEI--RDFFIKTLDDAEGGIKFMMARLS 298
            ||..||..:         |.|  .:|...|:..|||:.:|  .:|:.:||...:..     .|:|
 Worm   239 GMGVIVATL---------LLY--CSEETTFWMMTALIEDILPPNFYTQTLLGLQAD-----ERVS 287

  Fly   299 -NMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICC 362
             :::|.....:.:.|...|:.....:..||..|....|....:||:||.:|.......|  ::..
 Worm   288 RHLMKCHVPDLNKALEDYEVEVSLLTVSWLLTLFGSVFRTRVMLRVWDFIFYSGGVNIF--RVII 350

  Fly   363 SMILIQREAILE-----NDFASNVKLLQNYPP--IDINVVIAHAGS 401
            |::.::.:.|:|     ...|.....|...|.  .::..||.:.||
 Worm   351 SILKMKEQEIVEIAETTQSSADIFTALSQLPASVTEVEKVIEYMGS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 45/188 (24%)
tbc-18NP_509421.2 TBC 148..361 CDD:214540 48/204 (24%)
SH3_SGSM3 528..580 CDD:212747
RUN 607..765 CDD:280855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.