DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and tbc-16

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_508988.3 Gene:tbc-16 / 180856 WormBaseID:WBGene00018639 Length:725 Species:Caenorhabditis elegans


Alignment Length:287 Identity:71/287 - (24%)
Similarity:112/287 - (39%) Gaps:78/287 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 LHERVVPAVL------SSANVERKGLGMTKINL------ITKRSVENYAAMEEGQEAHW------ 214
            :.|:|.|.:|      |||: :|:.:   |.:|      |.||   .|...|..| |.|      
 Worm   416 MREKVWPFLLRVYPWESSAD-QRENI---KNDLFLEYQNIRKR---RYRVTENAQ-ARWISIENS 472

  Fly   215 -----------------------EVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTY 256
                                   |:::.||..||.:.|...|:|||::::.|:...:..      
 Worm   473 IVKDVVRTDRKNPFFAGDNNPNSEIMKNILLNYAVMYPDINYIQGMSDLLAPLLSTLKD------ 531

  Fly   257 RAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQY 321
                |.|.:|||...|.:  ..|..|....|..::..:..|.|||:......||.|..|......
 Worm   532 ----EVDSYFCFKNFMQQ--TVFSSTPQGNENLMETNLTYLRNMLRMFVPDFYEHLEKQRPDAMQ 590

  Fly   322 YSF--RWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILEND-------- 376
            ..|  ||:.|...:|||....|.||:..:|..:...|.:.:|.:::.|..:.:|..|        
 Worm   591 LMFVHRWILLCFKREFPENYALHIWECCWAHYRTNYFHLFVCVAIVSIYGKDVLTQDLPHDEILL 655

  Fly   377 -FASNVKLLQNYPPIDINVVIAHAGSL 402
             |||    |.|:  :|..:|:..|..|
 Worm   656 FFAS----LANH--MDATLVLQKARGL 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 52/218 (24%)
tbc-16NP_508988.3 DUF3548 32..>136 CDD:371881
TBC 415..644 CDD:214540 60/247 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.