DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and tbck-1

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001364726.1 Gene:tbck-1 / 173832 WormBaseID:WBGene00016352 Length:839 Species:Caenorhabditis elegans


Alignment Length:226 Identity:41/226 - (18%)
Similarity:98/226 - (43%) Gaps:23/226 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 VLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYV--QGMN 238
            ||:|.:.:|:    .::::......::|......||:    ::::|..:..:...|.:|  ||.:
 Worm   476 VLASHSSDRQ----LEVDIPRCHQYDSYMTTPAIQES----LRKVLKGWQIVTESQHFVYWQGCD 532

  Fly   239 EIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLKS 303
            .:..|......|.|.:.:....|....:|        ..|::|  |::| .||..:....:::..
 Worm   533 SLATPFLLANMSKPHVAFACFKEFTYRYC--------HKFYLK--DNSE-VIKEYLGIFYHLVAY 586

  Fly   304 KDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQ 368
            .|..:|:.|:......:.::..|.....:.|.||..::.:||........|..:|.:  :|:...
 Worm   587 TDPVLYKHLKINGFDAELFAIPWFLTCFAHELPLSKLVLLWDETMMHGNAFPLMIAL--AMLNRL 649

  Fly   369 REAILENDFASNVKLLQNYPPIDINVVIAHA 399
            |:.:|..:|...:.::.:.|.:.|:.:|.::
 Worm   650 RDKLLAVNFNEMIIIIHDQPDLSIDEIIKNS 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 32/183 (17%)
tbck-1NP_001364726.1 PKc_like <42..238 CDD:419665
TBC 444..654 CDD:214540 36/198 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.