DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D21

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006720472.1 Gene:TBC1D21 / 161514 HGNCID:28536 Length:399 Species:Homo sapiens


Alignment Length:377 Identity:68/377 - (18%)
Similarity:115/377 - (30%) Gaps:143/377 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RALSWKLLLGYLGPRRSSW-------TTTLAQKRALYK---QFIEELVLPPGHSSNRASVDGGDG 96
            |..:||.|.||.     ||       .|..:.:|..||   |..|::                  
Human    63 RTEAWKFLTGYF-----SWQSSQDERLTVDSMRRKNYKALCQMYEKI------------------ 104

  Fly    97 DKVDSGGVGLQDHPLSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSK 161
                        .||.|      |...|..|....|.:|:::                   ::.|
Human   105 ------------QPLLE------NLHRNFTETRNNIARDIQK-------------------IYDK 132

  Fly   162 GEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAK 226
            ...|               ||           ||.|:.:|                 :||.:...
Human   133 DPLG---------------NV-----------LIDKKRLE-----------------KILLLSYV 154

  Fly   227 LNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFI------KTLDD 285
            .|....|.||.:|:: .::.:|...         :.:.|:.|...:.:.....:      |.||.
Human   155 CNTQAEYQQGFHEMM-MLFQLMVEH---------DHETFWLFQFFLQKTEHSCVINIGVAKNLDM 209

  Fly   286 AEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEF-PLPDVLRIWDSVFA 349
            ....|.|:....:..||.|.....:.|           |.|......:.| ...||.|:|:.:..
Human   210 LSTLITFLDPVFAEHLKGKGAGAVQSL-----------FPWFCFCFQRAFKSFDDVWRLWEVLLT 263

  Fly   350 DEQRFDFLIKICCSMILIQREAILENDFASNVKLL--QNYPPIDINVVIAHA 399
            .:...:|.:.:..||:.:.||.:|:.....:..||  .|...:|.:.:|:.|
Human   264 GKPCRNFQVLVAYSMLQMVREQVLQESMGGDDILLACNNLIDLDADELISAA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 35/188 (19%)
TBC1D21XP_006720472.1 TBC 62..287 CDD:214540 61/347 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.