DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D8

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_005263919.1 Gene:TBC1D8 / 11138 HGNCID:17791 Length:1162 Species:Homo sapiens


Alignment Length:352 Identity:75/352 - (21%)
Similarity:122/352 - (34%) Gaps:116/352 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SEGPE----------SAWNTFFND---NEFLLQIDKDVRRL----CPD-------ISFFQQPTDY 152
            |:.|:          |.||..|.:   ...:.:.:| :|:|    .|:       :.|....|| 
Human   484 SQSPDSRMSREQIKISLWNDHFVEYGRTVCMFRTEK-IRKLVAMGIPESLRGRLWLLFSDAVTD- 546

  Fly   153 PCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVV 217
                :....|.:|..:.|.:....|.:..:||.          ..||:..:.|.:  .|.....:
Human   547 ----LASHPGYYGNLVEESLGKCCLVTEEIERD----------LHRSLPEHPAFQ--NETGIAAL 595

  Fly   218 QRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE-IRDFFIK 281
            :|:|..||..||..||.|.||.:...:         |.|....||  |:...|:... :.|:|..
Human   596 RRVLTAYAHRNPKIGYCQSMNILTSVL---------LLYTKEEEA--FWLLVAVCERMLPDYFNH 649

  Fly   282 TLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQY------------YSFRW-LTLLLSQ 333
            .:..|:                .|.|::|.|....| |:.            .|..| |||.|| 
Human   650 RVIGAQ----------------VDQSVFEELIKGHL-PELAEHMNDLSALASVSLSWFLTLFLS- 696

  Fly   334 EFPLPDVLRIWDSVFADEQRFDFLI----------KICCS-------MILIQREAILEND----- 376
            ..||...:.:.|..|.|..:..|.:          .:|.|       |||.:....::|:     
Human   697 IMPLESAVNVVDCFFYDGIKAIFQLGLAVLEANAEDLCSSKDDGQALMILSRFLDHIKNEDSPGP 761

  Fly   377 -------FASNVKLLQNYPPIDINVVI 396
                   |.|:.:  :.||..||:.:|
Human   762 PVGSHHAFFSDDQ--EPYPVTDISDLI 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 48/212 (23%)
TBC1D8XP_005263919.1 PH-GRAM1_TBC1D8 178..276 CDD:270156
PH-GRAM2_TBC1D8 318..413 CDD:270160
TBC 527..733 CDD:214540 53/251 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.