DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and TBC1D3I

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006722286.1 Gene:TBC1D3I / 102724862 HGNCID:32709 Length:610 Species:Homo sapiens


Alignment Length:265 Identity:48/265 - (18%)
Similarity:85/265 - (32%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GDGDK-------VDSGGVGLQDHPLS-EGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPT 150
            ||.:|       :|....|:   |:: .||  .|:...|..|..:                :.|.
Human   144 GDWEKYKSSRKLIDRAYKGM---PMNIRGP--MWSVLLNTEEMKM----------------KNPG 187

  Fly   151 DYPCEIVVHSKG----EHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQE 211
            .|.   ::..||    ||.:|: :|.|...|......|...|..:..|:                
Human   188 RYQ---IMKEKGKRSSEHIQRI-DRDVSGTLRKHIFFRDRYGTKQRELL---------------- 232

  Fly   212 AHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIR 276
                   .||..|.:.||..||.:.::.|.......:           .|.|.|:....|::..|
Human   233 -------HILLAYEEYNPEVGYCRDLSHIAALFLLYL-----------PEEDAFWALVQLLASER 279

  Fly   277 DFFIKTLDDAEGG-IKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDV 340
             ..::......|| ::.:..:..:::.:...........::|..|......|..:|.....|...
Human   280 -HSLQGFHSPNGGTVQGLQDQQEHVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLT 343

  Fly   341 LRIWD 345
            ||:||
Human   344 LRLWD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 25/156 (16%)
TBC1D3IXP_006722286.1 TBC 160..373 CDD:214540 44/249 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.