DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GAPsec and sgsm1b

DIOPT Version :9

Sequence 1:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_003199319.1 Gene:sgsm1b / 100535556 ZFINID:ZDB-GENE-091117-39 Length:1533 Species:Danio rerio


Alignment Length:440 Identity:86/440 - (19%)
Similarity:150/440 - (34%) Gaps:144/440 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKEFEDVLAGPQDLIDLKQLRKLAFNGVPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYK 72
            :|..:::.:|||:              ||..               .|:..||.:...:.|::.|
Zfish  1141 MKTSQNLSSGPQN--------------VPQT---------------APQTISWDSEHNRARSIIK 1176

  Fly    73 QFI--EELVLPPGHSSNRASVDGGD---------------------------------------- 95
            |..  |.....|..|.::.|.|..|                                        
Zfish  1177 QMTESESESCGPLTSLSKPSPDMSDDSPSALEMEEIPSSVVYMSSESSMCRTPLTLARPVAPCIA 1241

  Fly    96 -GDKVDSGGVGLQ--------------DHPLSEGPESAWNTFFNDNEFLLQIDK-DVRRLCPDIS 144
             |:|...|...|:              |..|||......|.|...:...:..|| |:......|.
Zfish  1242 AGEKSPMGMPALELCMEPGVNTTPEGTDSALSEEEPEMDNLFPKPDSLAVTGDKNDIASPVSSIG 1306

  Fly   145 FFQQPTDYPCEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEG 209
                 |.|..|:                         |:...|.:.:|:...:|...||...   
Zfish  1307 -----TTYSQEL-------------------------VDLYTLNLHRIDKDVQRCDRNYWYF--- 1338

  Fly   210 QEAHWEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSE 274
            ..|:.|.::.|:..|...:...||||||.:::.|:..::..          ||..|.|||.||..
Zfish  1339 TPANLEKLRNIMCSYVWQHLDIGYVQGMCDLLAPLLVILDD----------EAMAFSCFTELMKR 1393

  Fly   275 IRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQ-YYSFRWLTLLLSQEFPLP 338
            :...|     ...|.:....|.:.::::..|..::||::....:.. |:.:||..|...:|....
Zfish  1394 MNQNF-----PHGGAMDTHFANMRSLIQILDSELFELMQQNGDYTHFYFCYRWFLLDFKREMVYD 1453

  Fly   339 DVLRIWDSVFADEQRF----DFLIKICCSMILIQREAILEN--DFASNVK 382
            ||..:|::::|  .|:    .|::.|..:::.:.|:.||||  ||...:|
Zfish  1454 DVFSVWETIWA--ARYASSEHFVLFIALALVELYRDIILENNMDFTDIIK 1501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GAPsecNP_648245.2 TBC <191..373 CDD:214540 42/186 (23%)
sgsm1bXP_003199319.1 RUN 40..184 CDD:280855
PH_RUTBC 249..418 CDD:275431
Ehrlichia_rpt 652..1218 CDD:118064 18/105 (17%)
TBC <1321..1490 CDD:214540 42/188 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.