DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap1 and NPEPL1

DIOPT Version :9

Sequence 1:NP_648244.1 Gene:S-Lap1 / 38986 FlyBaseID:FBgn0035915 Length:555 Species:Drosophila melanogaster
Sequence 2:NP_078939.3 Gene:NPEPL1 / 79716 HGNCID:16244 Length:523 Species:Homo sapiens


Alignment Length:302 Identity:91/302 - (30%)
Similarity:139/302 - (46%) Gaps:38/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LTRQLQEMPSNLLTPTAFAQNVVEVLCKSGV------NVEVKVEGWAESQSMHAFLAVGKASCEP 288
            |..::.:.|.|.:....|.:.:.:|..:.|:      :.|:|..|:.      ....||||:..|
Human   180 LAARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFG------GIYGVGKAALHP 238

  Fly   289 PIFLELSYYGTCAEERPIVLVGQGITYDAGGLCLKKKKELFNMRGDMTGAAVVVATCRAVAGLRL 353
            |....||:....|.: .|..||:||.||.|||.:|.|..:..|:.|..|||.|:...||......
Human   239 PALAVLSHTPDGATQ-TIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQGF 302

  Fly   354 PVNIRGLIPLCENVVGCNSFRPGDMVKSMNGKTIEVQCTDHEDVLVLADALLYA-QNFCPKCIID 417
            ..|:..:..|.||.||.|:.||.|:....:|||:|:..||.|..|||||.:.|| ::.....|:|
Human   303 KDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIILD 367

  Fly   418 IGTCSGYMRQSLDEAACGVFTNSEILWQQ--IKHASMHTGDRVWRFPL-------WNFYSKAVRA 473
            :.|.:|....:..:....|.||| ..|:.  :| |....||.|  .||       ::.::.||  
Human   368 MATLTGAQGIATGKYHAAVLTNS-AEWEAACVK-AGRKCGDLV--HPLVYCPELHFSEFTSAV-- 426

  Fly   474 GGRSDVQNYGIGRGGRPCKAAA-FLREFV----PCGQWMHID 510
               :|::|....|...|...|. |:...:    | |.|:|:|
Human   427 ---ADMKNSVADRDNSPSSCAGLFIASHIGFDWP-GVWVHLD 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap1NP_648244.1 PRK00913 44..542 CDD:234863 91/302 (30%)
Peptidase_M17 55..541 CDD:238247 91/302 (30%)
NPEPL1NP_078939.3 Peptidase_M17 35..487 CDD:238247 91/302 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.