DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap1 and Npepl1

DIOPT Version :9

Sequence 1:NP_648244.1 Gene:S-Lap1 / 38986 FlyBaseID:FBgn0035915 Length:555 Species:Drosophila melanogaster
Sequence 2:XP_006235750.1 Gene:Npepl1 / 311671 RGDID:1311351 Length:524 Species:Rattus norvegicus


Alignment Length:296 Identity:86/296 - (29%)
Similarity:138/296 - (46%) Gaps:26/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LTRQLQEMPSNLLTPTAFAQNVVEVLCKSGVNVEVKVEGWAESQSMHAFLAVGKASCEPPIFLEL 294
            |..::.:.|.:.:....|.:.:.:|..:.|:...:..:...:::.......||||:..||....|
  Rat   180 LAARIVDTPCSEMNTDIFLEEISQVGRELGITPTIIRDEQLKTKGFGGIYGVGKAALHPPALAVL 244

  Fly   295 SYYGTCAEERPIVLVGQGITYDAGGLCLKKKKELFNMRGDMTGAAVVVATCRAVAGLRLPVNIRG 359
            |:....|.: .|..||:||.||.|||.:|.|..:..|:.|..|||.::...||........|:..
  Rat   245 SHTPDGATQ-TIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAILGAFRAAIKQGFKDNLHA 308

  Fly   360 LIPLCENVVGCNSFRPGDMVKSMNGKTIEVQCTDHEDVLVLADALLYA-QNFCPKCIIDIGTCSG 423
            :..|.||.||.|:.||.|:....:|||:|:..||.|..|||||.:.|| ::.....|:|:.|.:|
  Rat   309 VFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDLGADIIVDMATLTG 373

  Fly   424 YMRQSLDEAACGVFTNSEILWQQ--IKHASMHTGDRVWRFPL-------WNFYSKAVRAGGRSDV 479
            ....:..:....|.||| ..|:.  :| |....||.|  .||       ::.::.||     :|:
  Rat   374 AQGIATGKYHAAVLTNS-AEWEAACVK-AGQKCGDLV--HPLVYCPELHFSEFTSAV-----ADM 429

  Fly   480 QNYGIGRGGRPCKAAA-FLREFV----PCGQWMHID 510
            :|....|...|...|. |:...:    | |.|:|:|
  Rat   430 KNSVADRDNSPSSCAGLFIASHIGFDWP-GVWVHLD 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap1NP_648244.1 PRK00913 44..542 CDD:234863 86/296 (29%)
Peptidase_M17 55..541 CDD:238247 86/296 (29%)
Npepl1XP_006235750.1 Peptidase_M17 35..487 CDD:238247 86/296 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.