DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USP27X and usp-3

DIOPT Version :9

Sequence 1:NP_001138545.1 Gene:USP27X / 389856 HGNCID:13486 Length:438 Species:Homo sapiens
Sequence 2:NP_493434.3 Gene:usp-3 / 190579 WormBaseID:WBGene00013506 Length:550 Species:Caenorhabditis elegans


Alignment Length:382 Identity:112/382 - (29%)
Similarity:163/382 - (42%) Gaps:87/382 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    70 TSSFTIGL--RGLINLGNTCFMNCIVQALTHTPILRDF------------------------FLS 108
            |||..|..  ||:.|:|||||||.::|||......|::                        :|:
 Worm   219 TSSSEIAYRPRGMRNVGNTCFMNAVLQALASISEFREYIMSLSSLEDYIHDEKEPKNGGNYCYLT 283

Human   109 DRHRCEMPSPELCLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAAL 173
            |.:|       ..|:.:.:..|||       |..|.:.............|:||.|:|||:...:
 Worm   284 DEYR-------KLLISQSARSFRE-------PTAPNEFREAFISVCPRFRGFRQHDSHEFMRYFM 334

Human   174 DVLH---RHCKGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPG 235
            |.||   |.|:     |....|:..:..|.:.|.|.|||.|.||.|...|..||...|:|||:|.
 Worm   335 DSLHTEMRKCR-----KLPGMPDDKHTPISKYFEGTLQSSVICQTCRNCSNKIDEFMDLSLDIPA 394

Human   236 SCTSFWPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMN 300
            .          |.:|.         ..|:|||..|.:.|.|....|.:|..|::.|..:||:.:.
 Worm   395 Q----------RNASK---------VRLSDCLSTFFKLEMLEKGEKPECAKCKTKQTCSKQMFIR 440

Human   301 KLPVVACFHFKRFEHSAKQRRKITTYISFPL-ELDMTPFMASSKESRMNGQLQLPTNSGNNENKY 364
            |||.|.|.|.|||..:..:...|   |.||: :||:|.|:....:       :.|..       |
 Worm   441 KLPQVLCLHMKRFRDNGGKNDAI---IDFPMGQLDVTQFLTDDSD-------EAPCT-------Y 488

Human   365 SLFAVVNHQG-TLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK 420
            ||.:::.|.| ...||||.:|.:.: .:||:.||.|:.......|...:.|:|.|.|
 Worm   489 SLQSIIVHIGYGCGSGHYIAFGKRN-GRWFQFDDTVVKGVDEAHVSKQKAYVLLYTK 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USP27XNP_001138545.1 Peptidase_C19D 78..419 CDD:239125 106/369 (29%)
usp-3NP_493434.3 zf-UBP 53..111 CDD:366940
UCH 229..542 CDD:366104 106/368 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1867
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929408at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1591
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.